PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G142200.1.p
Common NameGLYMA_10G142200, Glyma10g28250.1, LOC100790184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 430aa    MW: 48312.8 Da    PI: 7.2062
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G142200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.5e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Glyma.10G142200.1.p 14 KGLWSPEEDEKLLNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding43.66.9e-1467110146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg+++++E+  +v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Glyma.10G142200.1.p  67 RGAFSQQEENMIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                          89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.857965IPR017930Myb domain
SuperFamilySSF466894.87E-2912108IPR009057Homeodomain-like
SMARTSM007175.2E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
CDDcd001678.51E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.8566116IPR017930Myb domain
SMARTSM007173.5E-1266114IPR001005SANT/Myb domain
PfamPF002491.5E-1267111IPR001005SANT/Myb domain
CDDcd001671.69E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNHIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENMIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPTTHKPLS EVENDKDMNM MPPSTDKSTQ KASVGSNEVV SNLVDHHQPP KTMPNSSSER  180
YPLEVSTTSS TQELFLDRFG TTTTTCHENN NNTSDLVGSY FSFQHLNYGT TTSMALSSNP  240
NTSLCFILPS TSSDINNNNS IITSSSMLPS IFPTQHVKLQ SNNNNPSSIS SDGVQNWETS  300
NNTNKNNGNM QLQSSTNYLD STWGVAESMK IVNINKEAQV VPLQAEQEDL KWSEYLNTPF  360
ILGNNTTQNH QIQTSQSIYT EVIKPETGFI IDESCTSNWH HHQPPPAFQL SDIYSKDLQR  420
FSVTFGQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.595800.0root| seed coat
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311950.0KT031195.1 Glycine max clone HN_CCL_35 MYB/HD-like transcription factor (Glyma10g28250.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535308.10.0PREDICTED: transcription factor MYB86-like
TrEMBLI1LAY20.0I1LAY2_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA10G28250.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.18e-95myb domain protein 61
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]